PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G47070.1
Common NameSPL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 881aa    MW: 98459.9 Da    PI: 5.6405
Description squamosa promoter binding protein-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G47070.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.8e-42105182178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+Ceadls++k+yhrrhkvCe+hska++++v g+ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  AT2G47070.1 105 VCQVENCEADLSKVKDYHRRHKVCEMHSKATSATVGGILQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNP 182
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-3399167IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547103180IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-39105184IPR004333Transcription factor, SBP-box
PfamPF031101.0E-30106179IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.73E-8674776IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.6E-8675777IPR020683Ankyrin repeat-containing domain
CDDcd002041.04E-9677773No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 881 aa     Download sequence    Send to blast
MEARIDEGGE AQQFYGSVGK RSVEWDLNDW KWDGDLFLAT QTTRGRQFFP LGNSSNSSSS  60
CSDEGNDKKR RAVAIQGDTN GALTLNLNGE SDGLFPAKKT KSGAVCQVEN CEADLSKVKD  120
YHRRHKVCEM HSKATSATVG GILQRFCQQC SRFHLLQEFD EGKRSCRRRL AGHNKRRRKT  180
NPEPGANGNP SDDHSSNYLL ITLLKILSNM HNHTGDQDLM SHLLKSLVSH AGEQLGKNLV  240
ELLLQGGGSQ GSLNIGNSAL LGIEQAPQEE LKQFSARQDG TATENRSEKQ VKMNDFDLND  300
IYIDSDDTDV ERSPPPTNPA TSSLDYPSWI HQSSPPQTSR NSDSASDQSP SSSSEDAQMR  360
TGRIVFKLFG KEPNEFPIVL RGQILDWLSH SPTDMESYIR PGCIVLTIYL RQAETAWEEL  420
SDDLGFSLGK LLDLSDDPLW TTGWIYVRVQ NQLAFVYNGQ VVVDTSLSLK SRDYSHIISV  480
KPLAIAATEK AQFTVKGMNL RQRGTRLLCS VEGKYLIQET THDSTTREDD DFKDNSEIVE  540
CVNFSCDMPI LSGRGFMEIE DQGLSSSFFP FLVVEDDDVC SEIRILETTL EFTGTDSAKQ  600
AMDFIHEIGW LLHRSKLGES DPNPGVFPLI RFQWLIEFSM DREWCAVIRK LLNMFFDGAV  660
GEFSSSSNAT LSELCLLHRA VRKNSKPMVE MLLRYIPKQQ RNSLFRPDAA GPAGLTPLHI  720
AAGKDGSEDV LDALTEDPAM VGIEAWKTCR DSTGFTPEDY ARLRGHFSYI HLIQRKINKK  780
STTEDHVVVN IPVSFSDREQ KEPKSGPMAS ALEITQIPCK LCDHKLVYGT TRRSVAYRPA  840
MLSMVAIAAV CVCVALLFKS CPEVLYVFQP FRWELLDYGT S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311051791084squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.125810.0flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453617510.0
Genevisible266763_at0.0
Expression AtlasAT2G47070-
AtGenExpressAT2G47070-
ATTED-IIAT2G47070-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development. {ECO:0000269|PubMed:10524240}.
Functional Description ? help Back to Top
Source Description
TAIRmember of SPL gene family, encodes DNA binding proteins and putative transcription factors. All have the SBP-box, which encodes the SBP-domain, required for and sufficient for interaction with DNA.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G47070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G47070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116290.0AJ011629.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 1.
GenBankAK2302690.0AK230269.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 1, complete cds, clone: RAFL23-28-L05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850468.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLD7LFY40.0D7LFY4_ARALL; Putative uncharacterized protein
STRINGAT2G47070.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Representative plantOGRP25951432
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  4. Rizhsky L,Davletova S,Liang H,Mittler R
    The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.
    J. Biol. Chem., 2004. 279(12): p. 11736-43
    [PMID:14722088]
  5. Birkenbihl RP,Jach G,Saedler H,Huijser P
    Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains.
    J. Mol. Biol., 2005. 352(3): p. 585-96
    [PMID:16095614]
  6. Kropat J, et al.
    A regulator of nutritional copper signaling in Chlamydomonas is an SBP domain protein that recognizes the GTAC core of copper response element.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(51): p. 18730-5
    [PMID:16352720]
  7. Huang Y,Li CY,Biddle KD,Gibson SI
    Identification, cloning and characterization of sis7 and sis10 sugar-insensitive mutants of Arabidopsis.
    BMC Plant Biol., 2008. 8: p. 104
    [PMID:18854047]
  8. Eubel H, et al.
    Novel proteins, putative membrane transporters, and an integrated metabolic network are revealed by quantitative proteomic analysis of Arabidopsis cell culture peroxisomes.
    Plant Physiol., 2008. 148(4): p. 1809-29
    [PMID:18931141]
  9. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]